SR9009 is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Updated 2026-02-10. Numbers and descriptions here follow the published literature rather than marketing material.
At the molecular level, SR9009 binds REV-ERBα and REV-ERBβ and alters their repressive activity on target genes. These nuclear receptors help regulate the circadian clock, lipid synthesis, glucose metabolism, and inflammatory pathways. By changing transcription, the compound can shift the timing or magnitude of downstream metabolic processes in model systems. It does not act through androgen receptors or adenosine receptors, which distinguishes it from several substances sold for athletic performance. Whether the same transcriptional changes occur in humans at tolerable exposures remains an open question because controlled human studies are lacking.
Preclinical reports describe effects on exercise endurance, mitochondrial content, and lipid profiles in rodents, but these findings come from specific experimental conditions. Many studies use high doses or delivery methods that may not translate directly to human use. SR9009 has been reported to have low oral bioavailability and a short half-life, which complicates interpretation of oral dosing studies. It is not established as safe or effective for any indication. Literature discussions often separate its pharmacological mechanism from unverified claims made in fitness and supplement markets.
SR9009 is a synthetic small molecule studied as an agonist of the nuclear receptors REV-ERBα and REV-ERBβ. These receptors help regulate circadian rhythms and metabolic gene expression. In laboratory experiments, SR9009 binds these receptors and alters transcription of genes involved in lipid handling, glucose metabolism, and mitochondrial function. It is not a naturally occurring compound and has no approved therapeutic use. Research interest stems from its ability to modify energy metabolism in cells and animal models.
In rodent studies, SR9009 has been reported to increase mitochondrial content in skeletal muscle and improve exercise endurance under some conditions. These findings led to popular descriptions such as an exercise mimetic, although that term oversimplifies the biology. Effects vary by dose, timing, tissue, and model. The compound's influence on circadian pathways means that time of administration can matter in experiments. Whether similar metabolic changes occur in humans remains largely unexplored in controlled published trials.
| Property | Value | Notes |
|---|---|---|
| Molecular formula | C20H24ClN3O4S | Derived from published structure. |
| Molecular weight | 437.94 g/mol | Calculated value. |
| Appearance | White to off-white solid | Typical for purified research samples. |
| Solubility | DMSO, ethanol; low in water | Class: poorly water-soluble. |
| Typical storage | -20 °C, desiccated, protected from light | Limits degradation. |
SR9009 is a synthetic small molecule studied as a REV-ERB agonist. REV-ERBα and REV-ERBβ are nuclear receptors that help regulate circadian rhythms and metabolic gene expression. The compound was identified in academic screening efforts to find synthetic ligands for these receptors. In cell and animal studies, SR9009 alters transcription of genes involved in lipid and glucose metabolism, and it can shift circadian behavior. It is not an approved therapeutic agent.
Mechanistically, SR9009 binds the ligand-binding domain of REV-ERBα/β and enhances recruitment of corepressor complexes. This represses target genes rather than activating them. Because REV-ERB proteins normally compete with ROR proteins at shared response elements, the net effect depends on tissue and timing. Researchers use SR9009 to probe how nuclear receptor signaling links the clock to metabolism, inflammation, and muscle biology. Findings are largely preclinical, and the precise contribution of each receptor subtype remains under study.
SR9009 is frequently discussed in fitness and research-chemical contexts, yet it has no approved medical indication. Regulatory agencies have not authorized it for human use, and it is not a standard prescription drug. Some sports organizations list it as a prohibited substance because of its potential performance-enhancing properties. Published human data are sparse, so claims about its effects in people often rely on animal models or anecdotal reports. Quality and identity of online materials can vary widely.
Preclinical reports have linked SR9009 to improved endurance and altered energy expenditure in rodents. Such findings have prompted interest in whether REV-ERB activation can influence skeletal muscle metabolism. However, the reported effects depend on dose, route, and experimental model, and replication across laboratories is limited. Human trials have not established comparable outcomes, so claims about exercise performance remain speculative. The absence of controlled human data is a central limitation in interpreting these observations.
The mechanism of action involves binding to REV-ERB receptors and recruiting corepressor complexes, which represses target gene transcription. This contrasts with many nuclear receptor agonists that activate transcription. Downstream effects may include changes in autophagy, mitochondrial biogenesis, and lipid handling, but the precise pathways remain an active area of study. Whether these molecular events translate into meaningful physiological effects in humans is unresolved. Most evidence comes from cultured cells and rodent models rather than human participants.
SR9009 stability depends on temperature, moisture, light, and solvent. Solid material is generally kept cool and dry, while solutions may require protection from repeated warming and cooling. Degradation can appear as color changes, precipitate, or new chromatographic peaks. Researchers should follow supplier instructions and their own stability data. Long-term storage conditions for human use have not been established because the compound lacks approved clinical formulation.
SR9009 is supplied as a solid research chemical, often in milligram quantities. Laboratories typically weigh it in a controlled environment because fine powders can disperse. Stock solutions are commonly prepared in dimethyl sulfoxide and stored in small aliquots to reduce freeze-thaw cycles. Personal protective equipment and chemical fume hoods are standard when handling unknown or potent compounds. These practices address laboratory safety rather than human use.
Identity and purity of SR9009 samples are usually checked with chromatographic and spectrometric methods. High-performance liquid chromatography can separate the compound from related impurities, while mass spectrometry provides molecular mass confirmation. Nuclear magnetic resonance spectroscopy may be used for structural verification in research settings. No single method proves biological activity, and certificates of analysis should be reviewed alongside raw data. Independent testing is often needed because online products vary widely.
==== A. The nasal soft tissues ==== Nasal skin – Like the underlying bone-and-cartilage (osseo-cartilaginous) support framework of the nose, the external skin is divided into vertical thirds (anatomic sections); from the glabella (the space between the eyebrows), to the bridge, to the tip, for corrective plastic surgery, the nasal skin is anatomically considered, as the: Upper third section – the skin of the upper nose is thin, subcutaneous fat layer is thicker and relatively distensible (flexible and mobile), but then tapers, adhering tightly to the osseo-cartilaginous framework, and becomes the thinner skin of the dorsal section, the bridge of the nose. Middle third section – the skin overlying the bridge of the nose (mid-dorsal section) is the thinnest, least distensible, nasal skin, because it most adheres to the support framework. Lower third section – the skin of the lower nose and tip is significantly thicker and less mobile due to a higher density of sebaceous glands. This increased thickness can often efface the underlying cartilaginous framework, requiring more aggressive surgical definition in the tip area. The subcutaneous fat layer is very thin. Nasal lining – At the vestibule, the human nose is lined with a mucous membrane of squamous epithelium, which tissue then transitions to become columnar respiratory epithelium, a pseudo-stratified, ciliated (lash-like) tissue with abundant seromucous glands, which maintains the nasal moisture and protects the respiratory tract from bacteriologic infection and foreign objects.
==== Freezing food ==== To preserve food over long periods, the temperature should be maintained below 0 °F (−18 °C). Careful thawing and immediate cooking are necessary to maintain food safety. Food frozen at −18 °C (0 °F) or below may be preserved almost indefinitely, although its quality is likely to deteriorate over time. The United States Department of Agriculture, Food Safety and Inspection Service, publishes a chart showing the suggested freezer storage time for common foods.
=== General === A 2020 study of data from 1999 to 2015 suggests that children living with married parents tended to have lower rates of early-life mortality than those living with unmarried or single parents and non-parents.
Sources: en.wikipedia.org
ALFA-tag, a de novo designed helical peptide tag (SRLEEELRRRLTE) for biochemical and microscopy applications. The tag is recognized by a repertoire of single-domain antibodies AviTag, a peptide allowing biotinylation by the enzyme BirA and so the protein can be isolated by streptavidin (GLNDIFEAQKIEWHE) EPEA-tag, commercially called CaptureSelect C-tag, a 4 AA peptide that is recognized by a VHH or single-domain camelid antibody which was discovered through phage display (EPEA) Calmodulin-tag, a peptide bound by the protein calmodulin (KRRWKKNFIAVSAANRFKKISSSGAL) iCapTag™ (intein Capture Tag), a self-removing peptide-based tag (MIKIATRKYLGKQNVYGIGVERDHNFALKNGFIAHN). The iCapTag™ is controlled by pH change. Typically the pH change occurs from pH 8.5 to pH 6.2 and causes release of tagless target-protein to eluent. If needed the pH shift and buffers can be optimized for protein-specific purification method (e.g., for membrane proteins detergent could be added to the buffers to increase solubility of the protein). In contrast to other protein purification methods, this method is not relaying on proteases to cleave off a tag from tag-protein complex. Instead, during elution phase since buffer pH is changed from 8.5 to pH 6.2 that triggers cleavage reaction resulting in a release of tagless target protein while highly engineered tag stays attached to the column. The expected purity of tagless target proteins or peptides is between 95-99%. The iCapTag™ contains patented component derived from Nostoc punctiforme (Npu) intein.
== Predicted properties == According to the periodic law, dubnium should belong to group 5, with vanadium, niobium, and tantalum. Several studies have investigated the properties of element 105 and found that they generally agreed with the predictions of the periodic law. Significant deviations may nevertheless occur, due to relativistic effects, which dramatically change physical properties on both atomic and macroscopic scales. These properties have remained challenging to measure for several reasons: the difficulties of production of superheavy atoms, the low rates of production, which only allows for microscopic scales, requirements for a radiochemistry laboratory to test the atoms, short half-lives of those atoms, and the presence of many unwanted activities apart from those of synthesis of superheavy atoms. So far, studies have only been performed on single atoms.
Most of the explosions targeted antennas and active military bases. Early reports suggested that the explosions were at Generalissimo Francisco de Miranda Air Base (La Carlota) and Fort Tiuna, two military installations in Caracas. Large explosions were also reported at Higuerote Airport, on the Venezuelan coast. Helicopters from the 160th Special Operations Aviation Regiment carried Delta Force soldiers into Caracas with air cover provided by the fighters and bombers. One helicopter was damaged by Venezuelan ground defenses but continued on its mission. Federal Bureau of Investigation (FBI) personnel, including the Hostage Rescue Team, accompanied the military to formally arrest Maduro at his compound. The strikes lasted half an hour. Smoke was seen rising from one military hangar in a Caracas base, while another was left unpowered. The strikes happened under the cover of darkness as a result of both the timing of the operation and the US military's disruption of power in the city of Caracas. Multiple shipping containers were destroyed and damaged in the La Guaira port strikes. Satellite imagery from Vantor showed at least five destroyed warehouses, burned vehicles, and a blown-up security post. An aircraft, believed to be a Beechcraft Baron, and a Buk-M2E surface-to-air missile system were destroyed at Higuerote Airport.
Sources: en.wikipedia.org
Increased glutamatergic activity is thought to be part of a compensatory mechanism to chronic GABAergic inhibition from benzodiazepines. Therefore, a gradual reduction regimen is recommended. Symptoms may also occur during a gradual dosage reduction, but are typically less severe and may persist as part of a protracted withdrawal syndrome for months after cessation of benzodiazepines. Approximately ten percent of patients experience a notable protracted withdrawal syndrome, which can persist for many months or in some cases a year or longer. Protracted symptoms tend to resemble those seen during the first couple of months of withdrawal, but usually are of a sub-acute level of severity. Such symptoms do gradually lessen over time, eventually disappearing altogether. Benzodiazepines have a reputation with patients and doctors for causing a severe and traumatic withdrawal; however, this is in large part due to the withdrawal process being poorly managed. Over-rapid withdrawal from benzodiazepines increases the severity of the withdrawal syndrome and increases the failure rate. A slow and gradual withdrawal customised to the individual and, if indicated, psychological support is the most effective way of managing the withdrawal. Opinion as to the time needed to complete withdrawal ranges from four weeks to several years.
==== Health care ==== Duterte vowed to improve the health care system, certifying the Universal Healthcare Bill as an urgent measure as early as July 2018. In February 2019, he signed the Universal Health Care Act, which automatically enrolls all Filipinos under the government's health insurance program. He also enacted the National Integrated Cancer Control Act which establishes a "national integrated" program to control and prevent cancer by making treatment more accessible and affordable, and the Philippine Mental Health Law, which provides free mental health services down to the barangay level while requiring hospitals to provide psychiatric, psychosocial and neurologic services. In December 2019, Duterte signed a law institutionalizing Malasakit Centers in all hospitals run by the Department of Health, allowing indigent patients to efficiently access financial medical assistance from various government agencies. Duterte ordered the full implementation of the Reproductive Health Law, banned smoking in public places nationwide, and set a price cap on select medicines.
==== Information laundering ==== Generative AI has been noted for its use by state-sponsored propaganda campaigns in information laundering. According to a 2025 report by Graphika, generative AI is used to launder articles from Chinese state media such as China Global Television Network through various social media sites in an attempt to disguise the articles' origin.
The use of animal gut strings by musicians can be traced back to the third dynasty of Egypt. In the recent past, strings were made out of lamb gut. With the advent of the modern era, musicians have tended to use strings made of silk, or synthetic materials such as nylon or steel. Some instrumentalists, however, still use gut strings in order to evoke the older tone quality. Although such strings were commonly referred to as "catgut" strings, cats were never used as a source for gut strings. Sheep gut was the original source for natural gut string used in racquets, such as for tennis. Today, synthetic strings are much more common, but the best gut strings are now made out of cow gut. Gut cord has also been used to produce strings for the snares that provide a snare drum's characteristic buzzing timbre. While the modern snare drum almost always uses metal wire rather than gut cord, the North African bendir frame drum still uses gut for this purpose. "Natural" sausage hulls, or casings, are made of animal gut, especially hog, beef, and lamb. The wrapping of kokoretsi, gardoubakia, and torcinello is made of lamb (or goat) gut. Haggis is traditionally boiled in, and served in, a sheep stomach. Chitterlings, a kind of food, consist of thoroughly washed pig's gut. Animal gut was used to make the cord lines in longcase clocks and for fusee movements in bracket clocks, but may be replaced by metal wire. The oldest known condoms, from 1640 AD, were made from animal intestine.
Sources: en.wikipedia.org
SR9009 is a synthetic REV-ERB agonist used in laboratory research. It is not an approved drug, and its effects in humans are not well characterized. It is often sold as a research chemical under the name Stenabolic.
No. SR9009 targets the nuclear receptors REV-ERBα and REV-ERBβ, not the androgen receptor. This mechanism differs from selective androgen receptor modulators and from exercise mimetics that act on PPARδ.
Published evidence is mainly preclinical, using cell cultures and animal models. Controlled human trials are not well documented in the public literature. Claims about human performance or health effects therefore remain unsupported by robust clinical data.
It is a synthetic research compound that activates REV-ERB nuclear receptors. It is not an approved drug or dietary supplement. Most information comes from cell and animal studies.